PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.E00951.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 257aa    MW: 27954.2 Da    PI: 6.3985
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.E00951.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB127.93.6e-4060152294
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                       r+ d+++Pian++rim++vlP++aki++dake +qe vsefisfvt+ea+ +c+r+ r t++++d+l a+a+lG++dy+epl+++l+k+r  +
  Migut.E00951.1.p  60 RDVDQYMPIANITRIMRRVLPSHAKIADDAKEAIQEYVSEFISFVTAEANWRCNRDYRSTVTPEDVLAAMASLGLDDYLEPLTLFLNKHRAEQ 152
                       788**************************************************************************************9754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.9E-3955159IPR009072Histone-fold
SuperFamilySSF471131.16E-3063159IPR009072Histone-fold
PfamPF008086.6E-2065129IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.3E-1293111No hitNo description
PRINTSPR006153.3E-12112130No hitNo description
PRINTSPR006153.3E-12131149No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MEKGGCSNIE HKYTRRARTS GIVIREGGVA PAAASTNATN IPAAALNTIG GQVNQQGFKR  60
DVDQYMPIAN ITRIMRRVLP SHAKIADDAK EAIQEYVSEF ISFVTAEANW RCNRDYRSTV  120
TPEDVLAAMA SLGLDDYLEP LTLFLNKHRA EQNSEQGSMN LLPQFVRQGG DAGARVGFID  180
NQQRQRTHTV HQPSPSPPPS ASTVGYYAPL PPSAATMEEE RDFGGLTPAI HEYMLRNHGG  240
GEGSSGGCEF DPFQKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A1e-3160149493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B1e-3160149493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A2e-3160149392NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012839452.11e-162PREDICTED: nuclear transcription factor Y subunit B-9-like
TrEMBLA0A022R5831e-120A0A022R583_ERYGU; Uncharacterized protein (Fragment)
STRINGVIT_19s0015g00580.t012e-40(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6044436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.19e-42NF-YB family protein